PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009607926.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 287aa    MW: 32950 Da    PI: 5.4046
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009607926.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM159.71.2e-49101381129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrF P+deelv++yL kk+++++     ++ e+d++++ePw+Lp+ +k +++ewyfFs rd+kyatg r+nrat+sgyWkatgkd++vl+ 
  XP_009607926.1  10 LPPGFRFYPSDEELVCHYLFKKIANEEALK-GTLVEIDLHTCEPWQLPEVAKLNSSEWYFFSFRDRKYATGFRTNRATTSGYWKATGKDRTVLDP 103
                     79***********************99544.78***************87788899**************************************9 PP

             NAM  96 .kgelvglkktLvfykgrapkgektdWvmheyrle 129
                      ++++vg++ktLvfyk+rap+g k+ W+mhe+rle
  XP_009607926.1 104 rTRTTVGMRKTLVFYKNRAPNGIKSGWIMHEFRLE 138
                     66778***************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.8E-608156IPR003441NAC domain
PROSITE profilePS5100557.44210156IPR003441NAC domain
PfamPF023653.1E-2711137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MGLRDIGATL PPGFRFYPSD EELVCHYLFK KIANEEALKG TLVEIDLHTC EPWQLPEVAK  60
LNSSEWYFFS FRDRKYATGF RTNRATTSGY WKATGKDRTV LDPRTRTTVG MRKTLVFYKN  120
RAPNGIKSGW IMHEFRLENP NIPPKEDWVL CRVFHKAKAE NSSNNNILSP QNMYEVGVVS  180
SPNNNMDQYH ALPFGGYRPN MAAAAVSQRP LHQSQKLFDL MEPESNQSSY TQLPQEMNKP  240
PSNDQIAEDE YGFLLDMNFE DPSLQDEGMH SSIEDLTFDN DNSLVFI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-47915616165NO APICAL MERISTEM PROTEIN
1ut4_B5e-47915616165NO APICAL MERISTEM PROTEIN
1ut7_A5e-47915616165NO APICAL MERISTEM PROTEIN
1ut7_B5e-47915616165NO APICAL MERISTEM PROTEIN
3swm_A5e-47915619168NAC domain-containing protein 19
3swm_B5e-47915619168NAC domain-containing protein 19
3swm_C5e-47915619168NAC domain-containing protein 19
3swm_D5e-47915619168NAC domain-containing protein 19
3swp_A5e-47915619168NAC domain-containing protein 19
3swp_B5e-47915619168NAC domain-containing protein 19
3swp_C5e-47915619168NAC domain-containing protein 19
3swp_D5e-47915619168NAC domain-containing protein 19
3ulx_A4e-471015615168Stress-induced transcription factor NAC1
4dul_A5e-47915616165NAC domain-containing protein 19
4dul_B5e-47915616165NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754482e-62HG975448.1 Solanum pennellii chromosome ch09, complete genome.
GenBankHG9755212e-62HG975521.1 Solanum lycopersicum chromosome ch09, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009607926.10.0PREDICTED: NAC domain-containing protein 21/22-like
SwissprotQ84TE62e-63NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLM1ANH81e-154M1ANH8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000266441e-153(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18822466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.12e-95NAC domain containing protein 74